PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7903s0034.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 202aa    MW: 22919.9 Da    PI: 8.4989
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7903s0034.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1864118256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++t+eq + Le+ F++n++++ +++e LAk+l L  rq+ vWFqNrRa+ k
  Bostr.7903s0034.1.p  64 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEALAKHLMLRPRQIEVWFQNRRARSK 118
                          78889************************************************98 PP

2HD-ZIP_I/II118.73.2e-3864152189
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          +kk+rl++eq++lLE+sF+++++L+p++K++la++L l+prq++vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr+
  Bostr.7903s0034.1.p  64 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEALAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNHRLHREVEELRA 152
                          69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-1845118IPR009057Homeodomain-like
SuperFamilySSF466891.88E-1847121IPR009057Homeodomain-like
PROSITE profilePS5007117.13560120IPR001356Homeobox domain
SMARTSM003892.4E-1762124IPR001356Homeobox domain
CDDcd000867.48E-1663121No hitNo description
PfamPF000466.6E-1664118IPR001356Homeobox domain
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
SMARTSM003402.3E-21120163IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-9120154IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEILPENSSN LDLTISVPGF SSSPPSDEGS GGGREQLKLD MNRLPSSEDG YDEEFSHDGS  60
APPRKKLRLT REQSRLLEDS FRQNHTLNPK QKEALAKHLM LRPRQIEVWF QNRRARSKLK  120
QTEMECEYLK RWFGSLTEQN HRLHREVEEL RAMKVGPPSV TSASSLTMCP RCERVTTTAS  180
LSMAVVAVPA KKTFPPQERE D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARSKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4311810.0AJ431181.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper (Athb17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876750.11e-137hypothetical protein ARALYDRAFT_346639
SwissprotQ8S9N61e-133ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLD7LLR21e-137D7LLR2_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50000311e-136(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.11e-119homeobox-leucine zipper protein 17